| Root: SCOPe 2.08 |
| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein CD1, alpha-3 domain [88615] (5 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88616] (12 PDB entries) |
| Domain d2q7ya1: 2q7y A:186-279 [150106] Other proteins in same PDB: d2q7ya2, d2q7yb_, d2q7yc2, d2q7yd_ automated match to d1onqa1 complexed with igc, nag, plm |
PDB Entry: 2q7y (more details), 1.95 Å
SCOPe Domain Sequences for d2q7ya1:
Sequence, based on SEQRES records: (download)
>d2q7ya1 b.1.1.2 (A:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw
>d2q7ya1 b.1.1.2 (A:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqa
tldveageeaglacrvkhsslggqdiilyw
Timeline for d2q7ya1:
View in 3DDomains from other chains: (mouse over for more information) d2q7yb_, d2q7yc1, d2q7yc2, d2q7yd_ |