Lineage for d2q7yc2 (2q7y C:7-185)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937553Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 2937606Species Mouse (Mus musculus) [TaxId:10090] [54457] (25 PDB entries)
  8. 2937616Domain d2q7yc2: 2q7y C:7-185 [150110]
    Other proteins in same PDB: d2q7ya1, d2q7yb_, d2q7yc1, d2q7yd_
    automated match to d1onqa2
    complexed with igc, nag, plm

Details for d2q7yc2

PDB Entry: 2q7y (more details), 1.95 Å

PDB Description: structure of the endogenous inkt cell ligand igb3 bound to mcd1d
PDB Compounds: (C:) T-cell surface glycoprotein CD1d1

SCOPe Domain Sequences for d2q7yc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q7yc2 d.19.1.1 (C:7-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d2q7yc2:

Click to download the PDB-style file with coordinates for d2q7yc2.
(The format of our PDB-style files is described here.)

Timeline for d2q7yc2: