Class a: All alpha proteins [46456] (286 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) contains one classic and one pseudo HhH motifs |
Family a.60.6.0: automated matches [254214] (1 protein) not a true family |
Protein automated matches [254482] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255046] (5 PDB entries) |
Domain d2bcua1: 2bcu A:250-328 [128313] Other proteins in same PDB: d2bcua2, d2bcua3 automated match to d1rzta1 protein/DNA complex; complexed with na, ppv |
PDB Entry: 2bcu (more details), 2.2 Å
SCOPe Domain Sequences for d2bcua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bcua1 a.60.6.0 (A:250-328) automated matches {Human (Homo sapiens) [TaxId: 9606]} tnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrm aekiieilesghlrkldhi
Timeline for d2bcua1: