SCOPe 2.04: Domain d2bcua1: 2bcu A:250-328

Lineage for d2bcua1 (2bcu A:250-328)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.0: automated matches [254214] (1 protein)
   not a true family

6. Protein automated matches [254482] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255046] (4 PDB entries)

8. Domain d2bcua1: 2bcu A:250-328 [128313]
   Other proteins in same PDB: d2bcua2, d2bcua3
   automated match to d1rzta1
   protein/DNA complex; complexed with na, ppv

Details for d2bcua1

PDB Entry: 2bcu, 2.2 Å

PDB Description: DNA polymerase lambda in complex with a DNA duplex containing an unpaired Damp and a T:T mismatch

PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d2bcua1:

Sequence; same for both SEQRES and ATOM records:

>d2bcua1 a.60.6.0 (A:250-328) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrm
aekiieilesghlrkldhi

Timeline for d2bcua1:

• d2bcua1 first appeared in SCOP 1.73
  
• d2bcua1 appears in SCOPe 2.03
  
• d2bcua1 appears in SCOPe 2.05
  
• d2bcua1 appears in the current release, SCOPe 2.08