![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
![]() | Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) ![]() |
![]() | Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins) insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain |
![]() | Protein automated matches [254484] (3 species) not a true protein |
![]() | Domain d2bcua3: 2bcu A:386-575 [128315] Other proteins in same PDB: d2bcua1, d2bcua2 automated match to d2bcva3 protein/DNA complex; complexed with na, ppv |
PDB Entry: 2bcu (more details), 2.2 Å
SCOPe Domain Sequences for d2bcua3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bcua3 d.218.1.2 (A:386-575) automated matches {Human (Homo sapiens) [TaxId: 9606]} rmpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvdvlithpdgrshrgifs rlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrrldiivvpysefacally ftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpgrvlptptekdvfrllgl pyrepaerdw
Timeline for d2bcua3: