Lineage for d1sqqa2 (1sqq A:234-446)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611057Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 2611058Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 2611059Family d.185.1.1: MPP-like [63412] (7 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 2611301Protein automated matches [254430] (2 species)
    not a true protein
  7. 2611319Species Cow (Bos taurus) [TaxId:9913] [254891] (2 PDB entries)
  8. 2611321Domain d1sqqa2: 1sqq A:234-446 [119008]
    Other proteins in same PDB: d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqe1, d1sqqe2, d1sqqf1, d1sqqg_, d1sqqh_, d1sqqi_, d1sqqj_, d1sqqk1
    automated match to d2fyua2
    complexed with fes, hem, ost, uq2

Details for d1sqqa2

PDB Entry: 1sqq (more details), 3 Å

PDB Description: crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
PDB Compounds: (A:) Ubiquinol-cytochrome-c reductase complex core protein I, mitochondrial precursor

SCOPe Domain Sequences for d1sqqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqqa2 d.185.1.1 (A:234-446) automated matches {Cow (Bos taurus) [TaxId: 9913]}
crftgsqichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssp
lasiaatnklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatese
vlrgknllrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcsk
yfydqcpavagfgpieqlpdynrirsgmfwlrf

SCOPe Domain Coordinates for d1sqqa2:

Click to download the PDB-style file with coordinates for d1sqqa2.
(The format of our PDB-style files is described here.)

Timeline for d1sqqa2: