Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) |
Family f.23.12.0: automated matches [254198] (1 protein) not a true family |
Protein automated matches [254432] (4 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [254897] (2 PDB entries) |
Domain d1sqqe1: 1sqq E:1-69 [238538] Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqe2, d1sqqf1, d1sqqg_, d1sqqh_, d1sqqi_, d1sqqj_, d1sqqk1 automated match to d1bcce2 complexed with fes, hem, ost, uq2 |
PDB Entry: 1sqq (more details), 3 Å
SCOPe Domain Sequences for d1sqqe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqqe1 f.23.12.0 (E:1-69) automated matches {Cow (Bos taurus) [TaxId: 9913]} shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs smsasadvl
Timeline for d1sqqe1: