SCOPe 2.07: Domain d1sqqc1: 1sqq C:261-379

Lineage for d1sqqc1 (1sqq C:261-379)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
   core: three transmembrane helices, up-and-down bundle

4. Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families)

5. Family f.32.1.0: automated matches [254197] (1 protein)
   not a true family

6. Protein automated matches [254431] (4 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [254896] (2 PDB entries)

8. Domain d1sqqc1: 1sqq C:261-379 [119011]
   Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqe1, d1sqqe2, d1sqqf1, d1sqqg_, d1sqqh_, d1sqqi_, d1sqqj_, d1sqqk1
   automated match to d2a06c2
   complexed with fes, hem, ost, uq2

Details for d1sqqc1

PDB Entry: 1sqq, 3 Å

PDB Description: crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)

PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d1sqqc1:

Sequence; same for both SEQRES and ATOM records:

>d1sqqc1 f.32.1.0 (C:261-379) automated matches {Cow (Bos taurus) [TaxId: 9913]}
plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl
sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw

Timeline for d1sqqc1:

• d1sqqc1 first appeared in SCOP 1.73
  
• d1sqqc1 appears in SCOPe 2.06
  
• d1sqqc1 appears in the current release, SCOPe 2.08