SCOPe 2.07: Domain d1sqqi_: 1sqq I:

Lineage for d1sqqi_ (1sqq I:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
   not a true fold

4. Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (4 families)
   not a true superfamily

5. Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (2 proteins)
   beta-hairpin and a short alpha-helix bound to the core subunits

6. Protein automated matches [254424] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [254879] (3 PDB entries)

8. Domain d1sqqi_: 1sqq I: [119018]
   Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqe1, d1sqqe2, d1sqqf1, d1sqqg_, d1sqqh_, d1sqqj_, d1sqqk1
   automated match to d2fyui_
   complexed with fes, hem, ost, uq2

Details for d1sqqi_

PDB Entry: 1sqq, 3 Å

PDB Description: crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)

PDB Compounds: (I:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) [Contains: Ubiquinol-cytochrome c reductase 8 kDa protein (Complex III subunit IX)]

SCOPe Domain Sequences for d1sqqi_:

Sequence; same for both SEQRES and ATOM records:

>d1sqqi_ d.184.1.3 (I:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg

Timeline for d1sqqi_:

• d1sqqi_ first appeared in SCOP 1.73, called d1sqqi1
  
• d1sqqi_ appears in SCOPe 2.06
  
• d1sqqi_ appears in the current release, SCOPe 2.08