SCOPe 2.07: Domain d1sqqg_: 1sqq G:

Lineage for d1sqqg_ (1sqq G:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family)
   automatically mapped to Pfam PF02939

5. Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)

6. Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
   together with cytochrome b binds to ubiquinone

7. Species Cow (Bos taurus) [TaxId:9913] [81503] (21 PDB entries)
   Uniprot P13271 #SP ! Uniprot P13271

8. Domain d1sqqg_: 1sqq G: [119016]
   Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqe1, d1sqqe2, d1sqqf1, d1sqqh_, d1sqqi_, d1sqqj_, d1sqqk1
   automated match to d1be3g_
   complexed with fes, hem, ost, uq2

Details for d1sqqg_

PDB Entry: 1sqq, 3 Å

PDB Description: crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)

PDB Compounds: (G:) ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c

SCOPe Domain Sequences for d1sqqg_:

Sequence; same for both SEQRES and ATOM records:

>d1sqqg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefekskrknpa

Timeline for d1sqqg_:

• d1sqqg_ first appeared in SCOP 1.73, called d1sqqg1
  
• d1sqqg_ appears in SCOPe 2.06
  
• d1sqqg_ appears in the current release, SCOPe 2.08