![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
![]() | Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
![]() | Family d.185.1.1: MPP-like [63412] (7 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
![]() | Protein automated matches [254430] (2 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [254891] (2 PDB entries) |
![]() | Domain d1sqqb1: 1sqq B:17-235 [119009] Other proteins in same PDB: d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqe1, d1sqqe2, d1sqqf1, d1sqqg_, d1sqqh_, d1sqqi_, d1sqqj_, d1sqqk1 automated match to d1bccb1 complexed with fes, hem, ost, uq2 |
PDB Entry: 1sqq (more details), 3 Å
SCOPe Domain Sequences for d1sqqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqqb1 d.185.1.1 (B:17-235) automated matches {Cow (Bos taurus) [TaxId: 9913]} vpphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslt tkgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwe vaalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvq nhftsarmaliglgvshpvlkqvaeqflnirgglglsga
Timeline for d1sqqb1: