SCOPe 2.05: Domain d1xnri_: 1xnr I:

Lineage for d1xnri_ (1xnr I:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Ribosomal protein S9 [54218] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54219] (39 PDB entries)
   Uniprot P80374

8. Domain d1xnri_: 1xnr I: [115634]
   Other proteins in same PDB: d1xnrb_, d1xnrc1, d1xnrc2, d1xnrd_, d1xnre1, d1xnre2, d1xnrf_, d1xnrg_, d1xnrh_, d1xnrj_, d1xnrk_, d1xnrl_, d1xnrm_, d1xnrn_, d1xnro_, d1xnrp_, d1xnrq_, d1xnrr_, d1xnrs_, d1xnrt_, d1xnrv_
   complexed with mg, par, zn

Details for d1xnri_

PDB Entry: 1xnr, 3.1 Å

PDB Description: Crystal Structure of an Inosine-Cytosine Wobble Base Pair in the Context of the Decoding Center

PDB Compounds: (I:) 16S Ribosomal protein S9

SCOPe Domain Sequences for d1xnri_:

Sequence; same for both SEQRES and ATOM records:

>d1xnri_ d.14.1.1 (I:) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

Timeline for d1xnri_:

• d1xnri_ first appeared in SCOP 1.71
  
• d1xnri_ appears in SCOPe 2.04
  
• d1xnri_ appears in SCOPe 2.06
  
• d1xnri_ appears in the current release, SCOPe 2.08