SCOPe 2.05: Domain d1xnrr_: 1xnr R:

Lineage for d1xnrr_ (1xnr R:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family)

5. Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)

6. Protein Ribosomal protein S18 [46913] (2 species)

7. Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
   Uniprot P80382

8. Domain d1xnrr_: 1xnr R: [115643]
   Other proteins in same PDB: d1xnrb_, d1xnrc1, d1xnrc2, d1xnrd_, d1xnre1, d1xnre2, d1xnrf_, d1xnrg_, d1xnrh_, d1xnri_, d1xnrj_, d1xnrk_, d1xnrl_, d1xnrm_, d1xnrn_, d1xnro_, d1xnrp_, d1xnrq_, d1xnrs_, d1xnrt_, d1xnrv_
   complexed with mg, par, zn

Details for d1xnrr_

PDB Entry: 1xnr, 3.1 Å

PDB Description: Crystal Structure of an Inosine-Cytosine Wobble Base Pair in the Context of the Decoding Center

PDB Compounds: (R:) 16S Ribosomal protein S18

SCOPe Domain Sequences for d1xnrr_:

Sequence; same for both SEQRES and ATOM records:

>d1xnrr_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

Timeline for d1xnrr_:

• d1xnrr_ first appeared in SCOP 1.71
  
• d1xnrr_ appears in SCOPe 2.04
  
• d1xnrr_ appears in SCOPe 2.06
  
• d1xnrr_ appears in the current release, SCOPe 2.08