Lineage for d1xnrn_ (1xnr N:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1965176Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1965177Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1965490Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 1965491Protein Ribosomal protein S14 [57753] (2 species)
  7. 1965517Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
    Uniprot P24320
  8. 1965530Domain d1xnrn_: 1xnr N: [115639]
    Other proteins in same PDB: d1xnrb_, d1xnrc1, d1xnrc2, d1xnrd_, d1xnre1, d1xnre2, d1xnrf_, d1xnrg_, d1xnrh_, d1xnri_, d1xnrj_, d1xnrk_, d1xnrl_, d1xnrm_, d1xnro_, d1xnrp_, d1xnrq_, d1xnrr_, d1xnrs_, d1xnrt_, d1xnrv_
    complexed with mg, par, zn

Details for d1xnrn_

PDB Entry: 1xnr (more details), 3.1 Å

PDB Description: Crystal Structure of an Inosine-Cytosine Wobble Base Pair in the Context of the Decoding Center
PDB Compounds: (N:) 16S Ribosomal protein S14

SCOPe Domain Sequences for d1xnrn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnrn_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOPe Domain Coordinates for d1xnrn_:

Click to download the PDB-style file with coordinates for d1xnrn_.
(The format of our PDB-style files is described here.)

Timeline for d1xnrn_: