Lineage for d1xnro_ (1xnr O:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725387Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 1725388Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 1725434Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
    automatically mapped to Pfam PF00312
  6. 1725435Protein Ribosomal protein S15 [47065] (3 species)
  7. 1725449Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)
    Uniprot P80378
  8. 1725463Domain d1xnro_: 1xnr O: [115640]
    Other proteins in same PDB: d1xnrb_, d1xnrc1, d1xnrc2, d1xnrd_, d1xnre1, d1xnre2, d1xnrf_, d1xnrg_, d1xnrh_, d1xnri_, d1xnrj_, d1xnrk_, d1xnrl_, d1xnrm_, d1xnrn_, d1xnrp_, d1xnrq_, d1xnrr_, d1xnrs_, d1xnrt_, d1xnrv_
    complexed with mg, par, zn

Details for d1xnro_

PDB Entry: 1xnr (more details), 3.1 Å

PDB Description: Crystal Structure of an Inosine-Cytosine Wobble Base Pair in the Context of the Decoding Center
PDB Compounds: (O:) 16S Ribosomal protein S15

SCOPe Domain Sequences for d1xnro_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnro_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOPe Domain Coordinates for d1xnro_:

Click to download the PDB-style file with coordinates for d1xnro_.
(The format of our PDB-style files is described here.)

Timeline for d1xnro_: