Lineage for d1qvgi_ (1qvg I:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390823Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 390824Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 390825Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 390826Protein Ribosomal protein L13 [52163] (2 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 390827Species Archaeon Haloarcula marismortui [TaxId:2238] [52164] (18 PDB entries)
  8. 390841Domain d1qvgi_: 1qvg I: [96401]
    Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_
    complexed with cd, cl, k, mg, na

Details for d1qvgi_

PDB Entry: 1qvg (more details), 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui

SCOP Domain Sequences for d1qvgi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvgi_ c.21.1.1 (I:) Ribosomal protein L13 {Archaeon Haloarcula marismortui}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlganktw

SCOP Domain Coordinates for d1qvgi_:

Click to download the PDB-style file with coordinates for d1qvgi_.
(The format of our PDB-style files is described here.)

Timeline for d1qvgi_: