Lineage for d1qvg2_ (1qvg 2:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 430156Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 430415Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (4 families) (S)
  5. 430458Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)
  6. 430459Protein Ribosomal protein L44e [57837] (1 species)
  7. 430460Species Archaeon Haloarcula marismortui [TaxId:2238] [57838] (18 PDB entries)
  8. 430474Domain d1qvg2_: 1qvg 2: [96390]
    Other proteins in same PDB: d1qvg1_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_
    complexed with cd, cl, k, mg, na

Details for d1qvg2_

PDB Entry: 1qvg (more details), 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui

SCOP Domain Sequences for d1qvg2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvg2_ g.41.8.3 (2:) Ribosomal protein L44e {Archaeon Haloarcula marismortui}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

SCOP Domain Coordinates for d1qvg2_:

Click to download the PDB-style file with coordinates for d1qvg2_.
(The format of our PDB-style files is described here.)

Timeline for d1qvg2_: