SCOP 1.67: Domain d1qvgg_: 1qvg G:

Lineage for d1qvgg_ (1qvg G:)

1. Root: SCOP 1.67

2. Class j: Peptides [58231] (111 folds)

3. Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)

4. Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family)

5. Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)

6. Protein Ribosomal protein L10 [64661] (1 species)
   two alpha-helical segments visible in the crystal structure

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [64662] (17 PDB entries)

8. Domain d1qvgg_: 1qvg G: [96399]
   Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_
   complexed with cd, cl, k, mg, na

Details for d1qvgg_

PDB Entry: 1qvg, 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui

SCOP Domain Sequences for d1qvgg_:

Sequence, based on SEQRES records:

>d1qvgg_ j.84.1.1 (G:) Ribosomal protein L10 {Archaeon Haloarcula marismortui}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records):

>d1qvgg_ j.84.1.1 (G:) Ribosomal protein L10 {Archaeon Haloarcula marismortui}
ipewkqeevdaivemiesrntlleraldd

Timeline for d1qvgg_:

• d1qvgg_ is new in SCOP 1.67
  
• d1qvgg_ appears in SCOP 1.69
  
• d1qvgg_ appears in the current release, SCOPe 2.08