Lineage for d1qvgg_ (1qvg G:)

  1. Root: SCOP 1.67
  2. 434008Class j: Peptides [58231] (111 folds)
  3. 435248Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 435249Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 435250Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 435251Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 435252Species Archaeon Haloarcula marismortui [TaxId:2238] [64662] (17 PDB entries)
  8. 435265Domain d1qvgg_: 1qvg G: [96399]
    Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_
    complexed with cd, cl, k, mg, na

Details for d1qvgg_

PDB Entry: 1qvg (more details), 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (G:)

SCOP Domain Sequences for d1qvgg_:

Sequence, based on SEQRES records: (download)

>d1qvgg_ j.84.1.1 (G:) Ribosomal protein L10 {Archaeon Haloarcula marismortui}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1qvgg_ j.84.1.1 (G:) Ribosomal protein L10 {Archaeon Haloarcula marismortui}
ipewkqeevdaivemiesrntlleraldd

SCOP Domain Coordinates for d1qvgg_:

Click to download the PDB-style file with coordinates for d1qvgg_.
(The format of our PDB-style files is described here.)

Timeline for d1qvgg_: