SCOP 1.67: Domain d1qvga2: 1qvg A:1-90

Lineage for d1qvga2 (1qvg A:1-90)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (17 proteins)
   barrel, closed; n=5, S=8

6. Protein N-terminal domain of ribosomal protein L2 [50299] (2 species)
   incomplete OB-fold lacking the last strand

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [50301] (18 PDB entries)
   includes the N-terminal tail

8. Domain d1qvga2: 1qvg A:1-90 [96392]
   Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_
   complexed with cd, cl, k, mg, na

Details for d1qvga2

PDB Entry: 1qvg, 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui

SCOP Domain Sequences for d1qvga2:

Sequence; same for both SEQRES and ATOM records:

>d1qvga2 b.40.4.5 (A:1-90) N-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvdaeiap

Timeline for d1qvga2:

• d1qvga2 is new in SCOP 1.67
  
• d1qvga2 appears in SCOP 1.69
  
• d1qvga2 appears in the current release, SCOPe 2.08