Lineage for d1qvgt_ (1qvg T:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 429921Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 429922Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (11 families) (S)
  5. 430049Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)
  6. 430050Protein Ribosomal protein L24e [57750] (1 species)
  7. 430051Species Archaeon Haloarcula marismortui [TaxId:2238] [57751] (18 PDB entries)
  8. 430065Domain d1qvgt_: 1qvg T: [96412]
    Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_
    complexed with cd, cl, k, mg, na

Details for d1qvgt_

PDB Entry: 1qvg (more details), 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui

SCOP Domain Sequences for d1qvgt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvgt_ g.39.1.6 (T:) Ribosomal protein L24e {Archaeon Haloarcula marismortui}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

SCOP Domain Coordinates for d1qvgt_:

Click to download the PDB-style file with coordinates for d1qvgt_.
(The format of our PDB-style files is described here.)

Timeline for d1qvgt_: