SCOP 1.67: Domain d1qvgp_: 1qvg P:

Lineage for d1qvgp_ (1qvg P:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.34: SH3-like barrel [50036] (15 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families)
   many known members contain KOW motif

5. Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)

6. Protein Ribosomal proteins L21e [50108] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [50109] (18 PDB entries)

8. Domain d1qvgp_: 1qvg P: [96408]
   Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgl_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_
   complexed with cd, cl, k, mg, na

Details for d1qvgp_

PDB Entry: 1qvg, 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui

SCOP Domain Sequences for d1qvgp_:

Sequence; same for both SEQRES and ATOM records:

>d1qvgp_ b.34.5.1 (P:) Ribosomal proteins L21e {Archaeon Haloarcula marismortui}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

Timeline for d1qvgp_:

• d1qvgp_ is new in SCOP 1.67
  
• d1qvgp_ appears in SCOP 1.69
  
• d1qvgp_ appears in the current release, SCOPe 2.08