Lineage for d1qvgl_ (1qvg L:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407471Fold d.12: Ribosomal proteins L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 407472Superfamily d.12.1: Ribosomal proteins L23 and L15e [54189] (2 families) (S)
  5. 407496Family d.12.1.2: L15e [54193] (1 protein)
    elaborated with additional structures
  6. 407497Protein Ribosomal protein L15e [54194] (1 species)
  7. 407498Species Archaeon Haloarcula marismortui [TaxId:2238] [54195] (18 PDB entries)
  8. 407512Domain d1qvgl_: 1qvg L: [96404]
    Other proteins in same PDB: d1qvg1_, d1qvg2_, d1qvga1, d1qvga2, d1qvgb_, d1qvgc_, d1qvgd_, d1qvge1, d1qvge2, d1qvgf_, d1qvgg_, d1qvgh_, d1qvgi_, d1qvgj_, d1qvgk_, d1qvgm_, d1qvgn_, d1qvgo_, d1qvgp_, d1qvgq_, d1qvgr_, d1qvgs_, d1qvgt_, d1qvgu_, d1qvgv_, d1qvgw_, d1qvgx_, d1qvgy_, d1qvgz_
    complexed with cd, cl, k, mg, na

Details for d1qvgl_

PDB Entry: 1qvg (more details), 2.9 Å

PDB Description: structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui

SCOP Domain Sequences for d1qvgl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvgl_ d.12.1.2 (L:) Ribosomal protein L15e {Archaeon Haloarcula marismortui}
arsaysyireawkrpkegqiaelmwhrmqewrnepavvrierptrldrarslgykakqgi
ivvrvairkgssrrtrfnkgrrskrmmvnritrkkniqriaeeranrkfpnlrvlnsysv
gedgrhkwhevilidpdhpaiksddqlswisrtrhrlrtfrgltsagrrcrglrgqgkgs
ekvrpslrvngaka

SCOP Domain Coordinates for d1qvgl_:

Click to download the PDB-style file with coordinates for d1qvgl_.
(The format of our PDB-style files is described here.)

Timeline for d1qvgl_: