SCOPe 2.08: Domain d1q811_: 1q81 1:

Lineage for d1q811_ (1q81 1:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
   automatically mapped to Pfam PF01780

6. Protein Ribosomal protein L37ae [57831] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [57832] (58 PDB entries)
   Uniprot P60619

8. Domain d1q811_: 1q81 1: [96094]
   Other proteins in same PDB: d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_
   protein/RNA complex; complexed with cd, cl, k, mg, na, ppu

Details for d1q811_

PDB Entry: 1q81, 2.95 Å

PDB Description: crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.

PDB Compounds: (1:) L37Ae 50S ribosomal protein

SCOPe Domain Sequences for d1q811_:

Sequence; same for both SEQRES and ATOM records:

>d1q811_ g.41.8.1 (1:) Ribosomal protein L37ae {Haloarcula marismortui [TaxId: 2238]}
rtgrfgpryglkirvrvadveikhkkkhkcpvcgfkklkragtgiwmcghcgykiaggcy
qpetvagkavmka

Timeline for d1q811_:

• d1q811_ first appeared in SCOP 1.67
  
• d1q811_ appears in SCOPe 2.07