SCOPe 2.08: Domain d1q81t_: 1q81 T:

Lineage for d1q81t_ (1q81 T:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.1: L23p [54190] (1 protein)
   automatically mapped to Pfam PF00276

6. Protein Ribosomal protein L23 [54191] (4 species)

7. Species Haloarcula marismortui [TaxId:2238] [54192] (58 PDB entries)
   Uniprot P12732

8. Domain d1q81t_: 1q81 T: [96117]
   Other proteins in same PDB: d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_
   protein/RNA complex; complexed with cd, cl, k, mg, na, ppu

Details for d1q81t_

PDB Entry: 1q81, 2.95 Å

PDB Description: crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.

PDB Compounds: (T:) 50S ribosomal protein L23P

SCOPe Domain Sequences for d1q81t_:

Sequence; same for both SEQRES and ATOM records:

>d1q81t_ d.12.1.1 (T:) Ribosomal protein L23 {Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

Timeline for d1q81t_:

• d1q81t_ first appeared in SCOP 1.67
  
• d1q81t_ appears in SCOPe 2.07