SCOPe 2.08: Domain d1q81f_: 1q81 F:

Lineage for d1q81f_ (1q81 F:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.77: RL5-like [55281] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654

4. Superfamily d.77.1: RL5-like [55282] (3 families)

5. Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)

6. Protein Ribosomal protein L5 [55284] (5 species)
   synonym: 50S ribosomal protein L5p, HMAL5, HL13

7. Species Haloarcula marismortui [TaxId:2238] [55285] (40 PDB entries)
   Uniprot P14124

8. Domain d1q81f_: 1q81 F: [96102]
   Other proteins in same PDB: d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_
   protein/RNA complex; complexed with cd, cl, k, mg, na, ppu

Details for d1q81f_

PDB Entry: 1q81, 2.95 Å

PDB Description: crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.

PDB Compounds: (F:) 50S ribosomal protein L5P

SCOPe Domain Sequences for d1q81f_:

Sequence, based on SEQRES records:

>d1q81f_ d.77.1.1 (F:) Ribosomal protein L5 {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev

Sequence, based on observed residues (ATOM records):

>d1q81f_ d.77.1.1 (F:) Ribosomal protein L5 {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hrlnpadavafiestydvev

Timeline for d1q81f_:

• d1q81f_ first appeared in SCOP 1.67
  
• d1q81f_ appears in SCOPe 2.07