Lineage for d1q81k_ (1q81 K:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855226Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 2855227Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 2855228Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 2855229Protein Ribosomal protein L13 [52163] (5 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 2855267Species Haloarcula marismortui [TaxId:2238] [52164] (40 PDB entries)
    Uniprot P29198
  8. 2855303Domain d1q81k_: 1q81 K: [96108]
    Other proteins in same PDB: d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_
    protein/RNA complex; complexed with cd, cl, k, mg, na, ppu

Details for d1q81k_

PDB Entry: 1q81 (more details), 2.95 Å

PDB Description: crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
PDB Compounds: (K:) 50S ribosomal protein L13P

SCOPe Domain Sequences for d1q81k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q81k_ c.21.1.1 (K:) Ribosomal protein L13 {Haloarcula marismortui [TaxId: 2238]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlganktw

SCOPe Domain Coordinates for d1q81k_:

Click to download the PDB-style file with coordinates for d1q81k_.
(The format of our PDB-style files is described here.)

Timeline for d1q81k_: