SCOPe 2.08: Domain d1q81g1: 1q81 G:1-79

Lineage for d1q81g1 (1q81 G:1-79)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)
   automatically mapped to Pfam PF00347

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (6 species)
   duplication: consists of two domains of this fold

7. Species Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries)
   Uniprot P14135

8. Domain d1q81g1: 1q81 G:1-79 [96103]
   Other proteins in same PDB: d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_
   protein/RNA complex; complexed with cd, cl, k, mg, na, ppu

Details for d1q81g1

PDB Entry: 1q81, 2.95 Å

PDB Description: crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.

PDB Compounds: (G:) 50S ribosomal protein L6P

SCOPe Domain Sequences for d1q81g1:

Sequence; same for both SEQRES and ATOM records:

>d1q81g1 d.141.1.1 (G:1-79) Ribosomal protein L6 {Haloarcula marismortui [TaxId: 2238]}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvteg

Timeline for d1q81g1:

• d1q81g1 first appeared in SCOP 1.67
  
• d1q81g1 appears in SCOPe 2.07