SCOPe 2.08: Domain d1k8a4_: 1k8a 4:

Lineage for d1k8a4_ (1k8a 4:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)
   automatically mapped to Pfam PF00935

6. Protein Ribosomal protein L44e [57837] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [57838] (40 PDB entries)
   Uniprot P32411

8. Domain d1k8a4_: 1k8a 4: [72144]
   Other proteins in same PDB: d1k8a1_, d1k8a2_, d1k8a3_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ag1, d1k8ag2, d1k8ah_, d1k8ai_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8an_, d1k8ao_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8au_, d1k8av_, d1k8aw_, d1k8ax_, d1k8ay_, d1k8az_
   complexed with cai, cd, cl, k, mg, na

Details for d1k8a4_

PDB Entry: 1k8a, 3 Å

PDB Description: Co-crystal structure of Carbomycin A bound to the 50S ribosomal subunit of Haloarcula marismortui

PDB Compounds: (4:) ribosomal protein l44e

SCOPe Domain Sequences for d1k8a4_:

Sequence; same for both SEQRES and ATOM records:

>d1k8a4_ g.41.8.3 (4:) Ribosomal protein L44e {Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

Timeline for d1k8a4_:

• d1k8a4_ first appeared in SCOP 1.61
  
• d1k8a4_ appears in SCOPe 2.07