Lineage for d1k8aj_ (1k8a J:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2168779Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2169032Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) (S)
  5. 2169033Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein)
  6. 2169034Protein Ribosomal protein L10e [54688] (2 species)
  7. 2169035Species Haloarcula marismortui [TaxId:2238] [54689] (58 PDB entries)
    Uniprot P60617
  8. 2169076Domain d1k8aj_: 1k8a J: [72154]
    Other proteins in same PDB: d1k8a1_, d1k8a2_, d1k8a3_, d1k8a4_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ag1, d1k8ag2, d1k8ah_, d1k8ai_, d1k8ak_, d1k8al_, d1k8am_, d1k8an_, d1k8ao_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8au_, d1k8av_, d1k8aw_, d1k8ax_, d1k8ay_, d1k8az_
    complexed with cai, cd, cl, k, mg, na

Details for d1k8aj_

PDB Entry: 1k8a (more details), 3 Å

PDB Description: Co-crystal structure of Carbomycin A bound to the 50S ribosomal subunit of Haloarcula marismortui
PDB Compounds: (J:) ribosomal protein l10e

SCOPe Domain Sequences for d1k8aj_:

Sequence, based on SEQRES records: (download)

>d1k8aj_ d.41.4.1 (J:) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]}
kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
leaarvaanryvqnsgaaanykfrirkfpfhvirenkaaaaaaaaaaadgmrapfgkpvg
taarvhganhifiawvnpdpnveeawrrakmkvtptinidsspagna

Sequence, based on observed residues (ATOM records): (download)

>d1k8aj_ d.41.4.1 (J:) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]}
kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
leaarvaanryvqnsgaaanykfrirkfpfhvirenkdgmrapfgkpvgtaarvhganhi
fiawvnpdpnveeawrrakmkvtptinidsspagna

SCOPe Domain Coordinates for d1k8aj_:

Click to download the PDB-style file with coordinates for d1k8aj_.
(The format of our PDB-style files is described here.)

Timeline for d1k8aj_: