Lineage for d1k8av_ (1k8a V:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035872Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)
    automatically mapped to Pfam PF01246
  6. 3035873Protein Ribosomal protein L24e [57750] (1 species)
  7. 3035874Species Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries)
    Uniprot P14116
  8. 3035901Domain d1k8av_: 1k8a V: [72166]
    Other proteins in same PDB: d1k8a1_, d1k8a2_, d1k8a3_, d1k8a4_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ag1, d1k8ag2, d1k8ah_, d1k8ai_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8an_, d1k8ao_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8au_, d1k8aw_, d1k8ax_, d1k8ay_, d1k8az_
    complexed with cai, cd, cl, k, mg, na

Details for d1k8av_

PDB Entry: 1k8a (more details), 3 Å

PDB Description: Co-crystal structure of Carbomycin A bound to the 50S ribosomal subunit of Haloarcula marismortui
PDB Compounds: (V:) ribosomal protein l24e

SCOPe Domain Sequences for d1k8av_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8av_ g.39.1.6 (V:) Ribosomal protein L24e {Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

SCOPe Domain Coordinates for d1k8av_:

Click to download the PDB-style file with coordinates for d1k8av_.
(The format of our PDB-style files is described here.)

Timeline for d1k8av_: