SCOPe 2.08: Domain d1k8au_: 1k8a U:

Lineage for d1k8au_ (1k8a U:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)

6. Protein Ribosomal proteins L24 (L24p) [50106] (4 species)

7. Species Haloarcula marismortui [TaxId:2238] [50107] (40 PDB entries)
   Uniprot P10972

8. Domain d1k8au_: 1k8a U: [72165]
   Other proteins in same PDB: d1k8a1_, d1k8a2_, d1k8a3_, d1k8a4_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ag1, d1k8ag2, d1k8ah_, d1k8ai_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8an_, d1k8ao_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8av_, d1k8aw_, d1k8ax_, d1k8ay_, d1k8az_
   complexed with cai, cd, cl, k, mg, na

Details for d1k8au_

PDB Entry: 1k8a, 3 Å

PDB Description: Co-crystal structure of Carbomycin A bound to the 50S ribosomal subunit of Haloarcula marismortui

PDB Compounds: (U:) ribosomal protein l24

SCOPe Domain Sequences for d1k8au_:

Sequence; same for both SEQRES and ATOM records:

>d1k8au_ b.34.5.1 (U:) Ribosomal proteins L24 (L24p) {Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

Timeline for d1k8au_:

• d1k8au_ first appeared in SCOP 1.61
  
• d1k8au_ appears in SCOPe 2.07