Class a: All alpha proteins [46456] (290 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) interrupted alpha-helix automatically mapped to Pfam PF00832 |
Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein) |
Protein Ribosomal protein L39e [48664] (1 species) |
Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries) Uniprot P22452 |
Domain d1k8a3_: 1k8a 3: [72143] Other proteins in same PDB: d1k8a1_, d1k8a2_, d1k8a4_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ag1, d1k8ag2, d1k8ah_, d1k8ai_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8an_, d1k8ao_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8au_, d1k8av_, d1k8aw_, d1k8ax_, d1k8ay_, d1k8az_ complexed with cai, cd, cl, k, mg, na |
PDB Entry: 1k8a (more details), 3 Å
SCOPe Domain Sequences for d1k8a3_:
Sequence, based on SEQRES records: (download)
>d1k8a3_ a.137.1.1 (3:) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]} gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde
>d1k8a3_ a.137.1.1 (3:) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]} gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde
Timeline for d1k8a3_:
View in 3D Domains from other chains: (mouse over for more information) d1k8a1_, d1k8a2_, d1k8a4_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ag1, d1k8ag2, d1k8ah_, d1k8ai_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8an_, d1k8ao_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8au_, d1k8av_, d1k8aw_, d1k8ax_, d1k8ay_, d1k8az_ |