Lineage for d1k8a3_ (1k8a 3:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2346684Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2346685Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
    automatically mapped to Pfam PF00832
  5. 2346686Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 2346687Protein Ribosomal protein L39e [48664] (1 species)
  7. 2346688Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
    Uniprot P22452
  8. 2346720Domain d1k8a3_: 1k8a 3: [72143]
    Other proteins in same PDB: d1k8a1_, d1k8a2_, d1k8a4_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ag1, d1k8ag2, d1k8ah_, d1k8ai_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8an_, d1k8ao_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8au_, d1k8av_, d1k8aw_, d1k8ax_, d1k8ay_, d1k8az_
    complexed with cai, cd, cl, k, mg, na

Details for d1k8a3_

PDB Entry: 1k8a (more details), 3 Å

PDB Description: Co-crystal structure of Carbomycin A bound to the 50S ribosomal subunit of Haloarcula marismortui
PDB Compounds: (3:) ribosomal protein l39e

SCOPe Domain Sequences for d1k8a3_:

Sequence, based on SEQRES records: (download)

>d1k8a3_ a.137.1.1 (3:) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d1k8a3_ a.137.1.1 (3:) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde

SCOPe Domain Coordinates for d1k8a3_:

Click to download the PDB-style file with coordinates for d1k8a3_.
(The format of our PDB-style files is described here.)

Timeline for d1k8a3_: