SCOPe 2.08: Domain d7f0ll_: 7f0l L:

Lineage for d7f0ll_ (7f0l L:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (68 PDB entries)
   Uniprot P02954

8. Domain d7f0ll_: 7f0l L: [422188]
   Other proteins in same PDB: d7f0l1_, d7f0l2_, d7f0l3_, d7f0l4_, d7f0l5_, d7f0l6_, d7f0l7_, d7f0l8_, d7f0la_, d7f0lb_, d7f0ld_, d7f0le_, d7f0lf_, d7f0lg_, d7f0li_, d7f0lj_, d7f0lk_, d7f0lm_, d7f0ln_, d7f0lo_, d7f0lp_, d7f0lq_, d7f0lr_, d7f0ls_, d7f0lt_, d7f0lv_, d7f0lw_, d7f0ly_, d7f0lz_
   automated match to d6z1jl_
   complexed with bcl, bph, cdl, fe, lda, lmt, pgv, spo, u10

Details for d7f0ll_

PDB Entry: 7f0l, 2.94 Å

PDB Description: structure of photosynthetic lh1-rc super-complex of rhodobacter sphaeroides monomer

PDB Compounds: (L:) Photosynthetic reaction center L subunit

SCOPe Domain Sequences for d7f0ll_:

Sequence; same for both SEQRES and ATOM records:

>d7f0ll_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaitff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d7f0ll_:

• d7f0ll_ is new in SCOPe 2.08-stable