Lineage for d7f0lt_ (7f0l T:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021592Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
    membrane all-alpha fold
  4. 3021593Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) (S)
  5. 3021594Family f.3.1.1: Light-harvesting complex subunits [56919] (2 proteins)
  6. 3021647Protein automated matches [404989] (4 species)
    not a true protein
  7. 3085471Species Rhodobacter sphaeroides [TaxId:1063] [421788] (1 PDB entry)
  8. 3085472Domain d7f0lt_: 7f0l T: [421789]
    Other proteins in same PDB: d7f0l1_, d7f0l3_, d7f0l5_, d7f0l7_, d7f0la_, d7f0ld_, d7f0lf_, d7f0li_, d7f0lk_, d7f0ll_, d7f0lm_, d7f0lo_, d7f0lq_, d7f0ls_, d7f0lv_, d7f0ly_
    automated match to d1jo5a_
    complexed with bcl, bph, cdl, fe, lda, lmt, pgv, spo, u10

Details for d7f0lt_

PDB Entry: 7f0l (more details), 2.94 Å

PDB Description: structure of photosynthetic lh1-rc super-complex of rhodobacter sphaeroides monomer
PDB Compounds: (T:) Antenna pigment protein beta chain

SCOPe Domain Sequences for d7f0lt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7f0lt_ f.3.1.1 (T:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
lgytgltdeqaqelhsvymsglwlfsavaivahlavyiwrpwf

SCOPe Domain Coordinates for d7f0lt_:

Click to download the PDB-style file with coordinates for d7f0lt_.
(The format of our PDB-style files is described here.)

Timeline for d7f0lt_:

  • d7f0lt_ is new in SCOPe 2.08-stable