Lineage for d7f0la_ (7f0l A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021592Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
    membrane all-alpha fold
  4. 3021593Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) (S)
  5. 3021656Family f.3.1.0: automated matches [254203] (1 protein)
    not a true family
  6. 3021657Protein automated matches [254444] (10 species)
    not a true protein
  7. 3085461Species Rhodobacter sphaeroides [TaxId:1063] [421778] (1 PDB entry)
  8. 3085681Domain d7f0la_: 7f0l A: [421998]
    Other proteins in same PDB: d7f0l2_, d7f0l4_, d7f0l6_, d7f0l8_, d7f0lb_, d7f0le_, d7f0lg_, d7f0lj_, d7f0ll_, d7f0lm_, d7f0ln_, d7f0lp_, d7f0lr_, d7f0lt_, d7f0lw_, d7f0lz_
    automated match to d7ddqd_
    complexed with bcl, bph, cdl, fe, lda, lmt, pgv, spo, u10

Details for d7f0la_

PDB Entry: 7f0l (more details), 2.94 Å

PDB Description: structure of photosynthetic lh1-rc super-complex of rhodobacter sphaeroides monomer
PDB Compounds: (A:) Light-harvesting protein B-875 alpha chain

SCOPe Domain Sequences for d7f0la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7f0la_ f.3.1.0 (A:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
mskfykiwmifdprrvfvaqgvflfllavmihlillstpsynwle

SCOPe Domain Coordinates for d7f0la_:

Click to download the PDB-style file with coordinates for d7f0la_.
(The format of our PDB-style files is described here.)

Timeline for d7f0la_:

  • d7f0la_ is new in SCOPe 2.08-stable