![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily) membrane all-alpha fold |
![]() | Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) ![]() |
![]() | Family f.3.1.1: Light-harvesting complex subunits [56919] (2 proteins) |
![]() | Protein automated matches [404989] (4 species) not a true protein |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [421788] (1 PDB entry) |
![]() | Domain d7f0le_: 7f0l E: [421938] Other proteins in same PDB: d7f0l1_, d7f0l3_, d7f0l5_, d7f0l7_, d7f0la_, d7f0ld_, d7f0lf_, d7f0li_, d7f0lk_, d7f0ll_, d7f0lm_, d7f0lo_, d7f0lq_, d7f0ls_, d7f0lv_, d7f0ly_ automated match to d1jo5a_ complexed with bcl, bph, cdl, fe, lda, lmt, pgv, spo, u10 |
PDB Entry: 7f0l (more details), 2.94 Å
SCOPe Domain Sequences for d7f0le_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7f0le_ f.3.1.1 (E:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]} lgytgltdeqaqelhsvymsglwlfsavaivahlavyiwrpwf
Timeline for d7f0le_:
![]() Domains from other chains: (mouse over for more information) d7f0l1_, d7f0l2_, d7f0l3_, d7f0l4_, d7f0l5_, d7f0l6_, d7f0l7_, d7f0l8_, d7f0la_, d7f0lb_, d7f0ld_, d7f0lf_, d7f0lg_, d7f0li_, d7f0lj_, d7f0lk_, d7f0ll_, d7f0lm_, d7f0ln_, d7f0lo_, d7f0lp_, d7f0lq_, d7f0lr_, d7f0ls_, d7f0lt_, d7f0lv_, d7f0lw_, d7f0ly_, d7f0lz_ |