Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein automated matches [190224] (17 species) not a true protein |
Species Rhodobacter sphaeroides [TaxId:1063] [186985] (34 PDB entries) |
Domain d7f0lm_: 7f0l M: [421795] Other proteins in same PDB: d7f0l1_, d7f0l2_, d7f0l3_, d7f0l4_, d7f0l5_, d7f0l6_, d7f0l7_, d7f0l8_, d7f0la_, d7f0lb_, d7f0ld_, d7f0le_, d7f0lf_, d7f0lg_, d7f0li_, d7f0lj_, d7f0lk_, d7f0ll_, d7f0ln_, d7f0lo_, d7f0lp_, d7f0lq_, d7f0lr_, d7f0ls_, d7f0lt_, d7f0lv_, d7f0lw_, d7f0ly_, d7f0lz_ automated match to d2j8dm_ complexed with bcl, bph, cdl, fe, lda, lmt, pgv, spo, u10 |
PDB Entry: 7f0l (more details), 2.94 Å
SCOPe Domain Sequences for d7f0lm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7f0lm_ f.26.1.1 (M:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]} aeyqniftqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn hgmapl
Timeline for d7f0lm_:
View in 3D Domains from other chains: (mouse over for more information) d7f0l1_, d7f0l2_, d7f0l3_, d7f0l4_, d7f0l5_, d7f0l6_, d7f0l7_, d7f0l8_, d7f0la_, d7f0lb_, d7f0ld_, d7f0le_, d7f0lf_, d7f0lg_, d7f0li_, d7f0lj_, d7f0lk_, d7f0ll_, d7f0ln_, d7f0lo_, d7f0lp_, d7f0lq_, d7f0lr_, d7f0ls_, d7f0lt_, d7f0lv_, d7f0lw_, d7f0ly_, d7f0lz_ |