SCOPe 2.08: Domain d1ao0b2: 1ao0 B:1-234

Lineage for d1ao0b2 (1ao0 B:1-234)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
   has slightly different topology than other families do

6. Protein Glutamine PRPP amidotransferase, N-terminal domain [56239] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [56240] (2 PDB entries)

8. Domain d1ao0b2: 1ao0 B:1-234 [41817]
   Other proteins in same PDB: d1ao0a1, d1ao0b1, d1ao0c1, d1ao0d1
   complexed with 5gp, adp, mg, sf4

Details for d1ao0b2

PDB Entry: 1ao0, 2.8 Å

PDB Description: glutamine phosphoribosylpyrophosphate (prpp) amidotransferase from b. subtilis complexed with adp and gmp

PDB Compounds: (B:) glutamine phosphoribosylpyrophosphate amidotransferase

SCOPe Domain Sequences for d1ao0b2:

Sequence, based on SEQRES records:

>d1ao0b2 d.153.1.1 (B:1-234) Glutamine PRPP amidotransferase, N-terminal domain {Bacillus subtilis [TaxId: 1423]}
cgvfgiwgheeapqityyglhslqhrgqegagivatdgekltahkgqglitevfqngels
kvkgkgaighvryataggggyenvqpllfrsqnngslalahngnlvnatqlkqqlenqgs
ifqtssdtevlahlikrsghftlkdqiknslsmlkgayaflimtetemivaldpnglrpl
sigmmgdayvvasetcafdvvgatylrevepgemliindegmkserfsmninrs

Sequence, based on observed residues (ATOM records):

>d1ao0b2 d.153.1.1 (B:1-234) Glutamine PRPP amidotransferase, N-terminal domain {Bacillus subtilis [TaxId: 1423]}
cgvfgiwgheeapqityyglhslqhrgqegagivatdgekltahkgqglitevfqngels
kvkgkgaighvryatgyenvqpllfrsqnngslalahngnlvnatqlkqqlenqgsifqt
ssdtevlahlikrsghftlkdqiknslsmlkgayaflimtetemivaldpnglrplsigm
mgdayvvasetcafdvvgatylrevepgemliindegmkserfsmninrs

Timeline for d1ao0b2:

• d1ao0b2 first appeared (with stable ids) in SCOP 1.55
  
• d1ao0b2 appears in SCOPe 2.07