Lineage for d1ao0b2 (1ao0 B:1-234)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36602Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily)
  4. 36603Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 36604Family d.153.1.1: Class II glutamine amidotransferases [56236] (3 proteins)
  6. 36621Protein Glutamine PRPP amidotransferase, N-terminal domain [56239] (2 species)
  7. 36622Species Bacillus subtilis [TaxId:1423] [56240] (2 PDB entries)
  8. 36628Domain d1ao0b2: 1ao0 B:1-234 [41817]
    Other proteins in same PDB: d1ao0a1, d1ao0b1, d1ao0c1, d1ao0d1

Details for d1ao0b2

PDB Entry: 1ao0 (more details), 2.8 Å

PDB Description: glutamine phosphoribosylpyrophosphate (prpp) amidotransferase from b. subtilis complexed with adp and gmp

SCOP Domain Sequences for d1ao0b2:

Sequence, based on SEQRES records: (download)

>d1ao0b2 d.153.1.1 (B:1-234) Glutamine PRPP amidotransferase, N-terminal domain {Bacillus subtilis}
cgvfgiwgheeapqityyglhslqhrgqegagivatdgekltahkgqglitevfqngels
kvkgkgaighvryataggggyenvqpllfrsqnngslalahngnlvnatqlkqqlenqgs
ifqtssdtevlahlikrsghftlkdqiknslsmlkgayaflimtetemivaldpnglrpl
sigmmgdayvvasetcafdvvgatylrevepgemliindegmkserfsmninrs

Sequence, based on observed residues (ATOM records): (download)

>d1ao0b2 d.153.1.1 (B:1-234) Glutamine PRPP amidotransferase, N-terminal domain {Bacillus subtilis}
cgvfgiwgheeapqityyglhslqhrgqegagivatdgekltahkgqglitevfqngels
kvkgkgaighvryatgyenvqpllfrsqnngslalahngnlvnatqlkqqlenqgsifqt
ssdtevlahlikrsghftlkdqiknslsmlkgayaflimtetemivaldpnglrplsigm
mgdayvvasetcafdvvgatylrevepgemliindegmkserfsmninrs

SCOP Domain Coordinates for d1ao0b2:

Click to download the PDB-style file with coordinates for d1ao0b2.
(The format of our PDB-style files is described here.)

Timeline for d1ao0b2: