PDB entry 1ao0

View 1ao0 on RCSB PDB site
Description: glutamine phosphoribosylpyrophosphate (prpp) amidotransferase from b. subtilis complexed with ADP and gmp
Class: tglutamine amidotransferase
Keywords: transferase, glutamine amidotransferase, prtase, purine biosynthesis, phosphoribosyltransferase, glycosyltransferase, tglutamine amidotransferase
Deposited on 1997-07-15, released 1997-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.214
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamine phosphoribosylpyrophosphate amidotransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PURF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00497 (0-458)
      • sequence correction (401)
    Domains in SCOPe 2.07: d1ao0a1, d1ao0a2
  • Chain 'B':
    Compound: glutamine phosphoribosylpyrophosphate amidotransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PURF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00497 (0-458)
      • sequence correction (401)
    Domains in SCOPe 2.07: d1ao0b1, d1ao0b2
  • Chain 'C':
    Compound: glutamine phosphoribosylpyrophosphate amidotransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PURF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00497 (0-458)
      • sequence correction (401)
    Domains in SCOPe 2.07: d1ao0c1, d1ao0c2
  • Chain 'D':
    Compound: glutamine phosphoribosylpyrophosphate amidotransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PURF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00497 (0-458)
      • sequence correction (401)
    Domains in SCOPe 2.07: d1ao0d1, d1ao0d2
  • Heterogens: MG, SF4, 5GP, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ao0A (A:)
    cgvfgiwgheeapqityyglhslqhrgqegagivatdgekltahkgqglitevfqngels
    kvkgkgaighvryataggggyenvqpllfrsqnngslalahngnlvnatqlkqqlenqgs
    ifqtssdtevlahlikrsghftlkdqiknslsmlkgayaflimtetemivaldpnglrpl
    sigmmgdayvvasetcafdvvgatylrevepgemliindegmkserfsmninrsicsmey
    iyfsrpdsnidginvhsarknlgkmlaqesaveadvvtgvpdssisaaigyaeatgipye
    lgliknryvgrtfiqpsqalreqgvrmklsavrgvvegkrvvmvddsivrgttsrrivtm
    lreagatevhvkissppiahpcfygidtstheeliasshsveeirqeigadtlsflsveg
    llkgigrkyddsncgqclacftgkypteiyqdtvlphvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ao0A (A:)
    cgvfgiwgheeapqityyglhslqhrgqegagivatdgekltahkgqglitevfqngels
    kvkgkgaighvryatgyenvqpllfrsqnngslalahngnlvnatqlkqqlenqgsifqt
    ssdtevlahlikrsghftlkdqiknslsmlkgayaflimtetemivaldpnglrplsigm
    mgdayvvasetcafdvvgatylrevepgemliindegmkserfsmninrsicsmeyiyfs
    rpdsnidginvhsarknlgkmlaqesaveadvvtgvpdssisaaigyaeatgipyelgli
    knryvgrtfiqpsqalreqgvrmklsavrgvvegkrvvmvddsivrgttsrrivtmlrea
    gatevhvkissppiahpcfygidtstheeliasshsveeirqeigadtlsflsvegllkg
    igrkyddsncgqclacftgkypteiyqdtvlphvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ao0B (B:)
    cgvfgiwgheeapqityyglhslqhrgqegagivatdgekltahkgqglitevfqngels
    kvkgkgaighvryataggggyenvqpllfrsqnngslalahngnlvnatqlkqqlenqgs
    ifqtssdtevlahlikrsghftlkdqiknslsmlkgayaflimtetemivaldpnglrpl
    sigmmgdayvvasetcafdvvgatylrevepgemliindegmkserfsmninrsicsmey
    iyfsrpdsnidginvhsarknlgkmlaqesaveadvvtgvpdssisaaigyaeatgipye
    lgliknryvgrtfiqpsqalreqgvrmklsavrgvvegkrvvmvddsivrgttsrrivtm
    lreagatevhvkissppiahpcfygidtstheeliasshsveeirqeigadtlsflsveg
    llkgigrkyddsncgqclacftgkypteiyqdtvlphvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ao0B (B:)
    cgvfgiwgheeapqityyglhslqhrgqegagivatdgekltahkgqglitevfqngels
    kvkgkgaighvryatgyenvqpllfrsqnngslalahngnlvnatqlkqqlenqgsifqt
    ssdtevlahlikrsghftlkdqiknslsmlkgayaflimtetemivaldpnglrplsigm
    mgdayvvasetcafdvvgatylrevepgemliindegmkserfsmninrsicsmeyiyfs
    rpdsnidginvhsarknlgkmlaqesaveadvvtgvpdssisaaigyaeatgipyelgli
    knryvgrtfiqpsqalreqgvrmklsavrgvvegkrvvmvddsivrgttsrrivtmlrea
    gatevhvkissppiahpcfygidtstheeliasshsveeirqeigadtlsflsvegllkg
    igrkyddsncgqclacftgkypteiyqdtvlphvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ao0C (C:)
    cgvfgiwgheeapqityyglhslqhrgqegagivatdgekltahkgqglitevfqngels
    kvkgkgaighvryataggggyenvqpllfrsqnngslalahngnlvnatqlkqqlenqgs
    ifqtssdtevlahlikrsghftlkdqiknslsmlkgayaflimtetemivaldpnglrpl
    sigmmgdayvvasetcafdvvgatylrevepgemliindegmkserfsmninrsicsmey
    iyfsrpdsnidginvhsarknlgkmlaqesaveadvvtgvpdssisaaigyaeatgipye
    lgliknryvgrtfiqpsqalreqgvrmklsavrgvvegkrvvmvddsivrgttsrrivtm
    lreagatevhvkissppiahpcfygidtstheeliasshsveeirqeigadtlsflsveg
    llkgigrkyddsncgqclacftgkypteiyqdtvlphvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ao0C (C:)
    cgvfgiwgheeapqityyglhslqhrgqegagivatdgekltahkgqglitevfqngels
    kvkgkgaighvryatgyenvqpllfrsqnngslalahngnlvnatqlkqqlenqgsifqt
    ssdtevlahlikrsghftlkdqiknslsmlkgayaflimtetemivaldpnglrplsigm
    mgdayvvasetcafdvvgatylrevepgemliindegmkserfsmninrsicsmeyiyfs
    rpdsnidginvhsarknlgkmlaqesaveadvvtgvpdssisaaigyaeatgipyelgli
    knryvgrtfiqpsqalreqgvrmklsavrgvvegkrvvmvddsivrgttsrrivtmlrea
    gatevhvkissppiahpcfygidtstheeliasshsveeirqeigadtlsflsvegllkg
    igrkyddsncgqclacftgkypteiyqdtvlphvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ao0D (D:)
    cgvfgiwgheeapqityyglhslqhrgqegagivatdgekltahkgqglitevfqngels
    kvkgkgaighvryataggggyenvqpllfrsqnngslalahngnlvnatqlkqqlenqgs
    ifqtssdtevlahlikrsghftlkdqiknslsmlkgayaflimtetemivaldpnglrpl
    sigmmgdayvvasetcafdvvgatylrevepgemliindegmkserfsmninrsicsmey
    iyfsrpdsnidginvhsarknlgkmlaqesaveadvvtgvpdssisaaigyaeatgipye
    lgliknryvgrtfiqpsqalreqgvrmklsavrgvvegkrvvmvddsivrgttsrrivtm
    lreagatevhvkissppiahpcfygidtstheeliasshsveeirqeigadtlsflsveg
    llkgigrkyddsncgqclacftgkypteiyqdtvlphvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ao0D (D:)
    cgvfgiwgheeapqityyglhslqhrgqegagivatdgekltahkgqglitevfqngels
    kvkgkgaighvryatgyenvqpllfrsqnngslalahngnlvnatqlkqqlenqgsifqt
    ssdtevlahlikrsghftlkdqiknslsmlkgayaflimtetemivaldpnglrplsigm
    mgdayvvasetcafdvvgatylrevepgemliindegmkserfsmninrsicsmeyiyfs
    rpdsnidginvhsarknlgkmlaqesaveadvvtgvpdssisaaigyaeatgipyelgli
    knryvgrtfiqpsqalreqgvrmklsavrgvvegkrvvmvddsivrgttsrrivtmlrea
    gatevhvkissppiahpcfygidtstheeliasshsveeirqeigadtlsflsvegllkg
    igrkyddsncgqclacftgkypteiyqdtvlphvk