![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
![]() | Protein Glutamine PRPP amidotransferase, C-terminal domain [53278] (3 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [53279] (2 PDB entries) |
![]() | Domain d1ao0d1: 1ao0 D:235-459 [34052] Other proteins in same PDB: d1ao0a2, d1ao0b2, d1ao0c2, d1ao0d2 complexed with 5gp, adp, mg, sf4 |
PDB Entry: 1ao0 (more details), 2.8 Å
SCOPe Domain Sequences for d1ao0d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ao0d1 c.61.1.1 (D:235-459) Glutamine PRPP amidotransferase, C-terminal domain {Bacillus subtilis [TaxId: 1423]} icsmeyiyfsrpdsnidginvhsarknlgkmlaqesaveadvvtgvpdssisaaigyaea tgipyelgliknryvgrtfiqpsqalreqgvrmklsavrgvvegkrvvmvddsivrgtts rrivtmlreagatevhvkissppiahpcfygidtstheeliasshsveeirqeigadtls flsvegllkgigrkyddsncgqclacftgkypteiyqdtvlphvk
Timeline for d1ao0d1: