Lineage for d1ao0d2 (1ao0 D:1-234)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988341Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
    has slightly different topology than other families do
  6. 2988409Protein Glutamine PRPP amidotransferase, N-terminal domain [56239] (3 species)
  7. 2988410Species Bacillus subtilis [TaxId:1423] [56240] (2 PDB entries)
  8. 2988414Domain d1ao0d2: 1ao0 D:1-234 [41819]
    Other proteins in same PDB: d1ao0a1, d1ao0b1, d1ao0c1, d1ao0d1
    complexed with 5gp, adp, mg, sf4

Details for d1ao0d2

PDB Entry: 1ao0 (more details), 2.8 Å

PDB Description: glutamine phosphoribosylpyrophosphate (prpp) amidotransferase from b. subtilis complexed with adp and gmp
PDB Compounds: (D:) glutamine phosphoribosylpyrophosphate amidotransferase

SCOPe Domain Sequences for d1ao0d2:

Sequence, based on SEQRES records: (download)

>d1ao0d2 d.153.1.1 (D:1-234) Glutamine PRPP amidotransferase, N-terminal domain {Bacillus subtilis [TaxId: 1423]}
cgvfgiwgheeapqityyglhslqhrgqegagivatdgekltahkgqglitevfqngels
kvkgkgaighvryataggggyenvqpllfrsqnngslalahngnlvnatqlkqqlenqgs
ifqtssdtevlahlikrsghftlkdqiknslsmlkgayaflimtetemivaldpnglrpl
sigmmgdayvvasetcafdvvgatylrevepgemliindegmkserfsmninrs

Sequence, based on observed residues (ATOM records): (download)

>d1ao0d2 d.153.1.1 (D:1-234) Glutamine PRPP amidotransferase, N-terminal domain {Bacillus subtilis [TaxId: 1423]}
cgvfgiwgheeapqityyglhslqhrgqegagivatdgekltahkgqglitevfqngels
kvkgkgaighvryatgyenvqpllfrsqnngslalahngnlvnatqlkqqlenqgsifqt
ssdtevlahlikrsghftlkdqiknslsmlkgayaflimtetemivaldpnglrplsigm
mgdayvvasetcafdvvgatylrevepgemliindegmkserfsmninrs

SCOPe Domain Coordinates for d1ao0d2:

Click to download the PDB-style file with coordinates for d1ao0d2.
(The format of our PDB-style files is described here.)

Timeline for d1ao0d2: