SCOPe 2.08: Domain d6jo6l_: 6jo6 L:

Lineage for d6jo6l_ (6jo6 L:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily)
   core: three transmembrane helices, bundle

4. Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families)
   automatically mapped to Pfam PF02605

5. Family f.31.1.0: automated matches [375525] (1 protein)
   not a true family

6. Protein automated matches [375526] (6 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [420020] (5 PDB entries)

8. Domain d6jo6l_: 6jo6 L: [411346]
   Other proteins in same PDB: d6jo61_, d6jo63_, d6jo64_, d6jo65_, d6jo67_, d6jo68_, d6jo6a_, d6jo6b_, d6jo6c_, d6jo6d_, d6jo6e_, d6jo6f_, d6jo6j_, d6jo6z_
   automated match to d6k61l_
   complexed with bcr, chl, cl0, cla, dgd, lhg, lmg, lut, pqn, sf4

Details for d6jo6l_

PDB Entry: 6jo6, 2.9 Å

PDB Description: structure of the green algal photosystem i supercomplex with light- harvesting complex i

PDB Compounds: (L:) Photosystem I reaction center subunit XI

SCOPe Domain Sequences for d6jo6l_:

Sequence, based on SEQRES records:

>d6jo6l_ f.31.1.0 (L:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
gmletpvtsapivatylsnlpayrtgvapvlrgveiglahgfllagpfiklgplrnvpet
aeiagslsaaglvlilalclsiygsaqfqstpsigvktlsgrsvardplfsadgwsefaa
gflvggeagvawayvc

Sequence, based on observed residues (ATOM records):

>d6jo6l_ f.31.1.0 (L:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
gmletpvtsapivatylsnlpayrtgvapvlrgveiglahgfllagpfiklgplrnvpet
aeiagslsaaglvlilalclsiygsaqfqplfsadgwsefaagflvggeagvawayvc

Timeline for d6jo6l_:

• d6jo6l_ is new in SCOPe 2.08-stable