Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily) membrane all-alpha fold; three transmembrane helices |
Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) duplication: contains two structural repeats |
Family f.43.1.0: automated matches [276197] (1 protein) not a true family |
Protein automated matches [276200] (4 species) not a true protein |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [370435] (9 PDB entries) |
Domain d6jo64_: 6jo6 4: [370472] Other proteins in same PDB: d6jo6a_, d6jo6b_, d6jo6c_, d6jo6d_, d6jo6e_, d6jo6f_, d6jo6j_, d6jo6l_ automated match to d5xnls_ complexed with bcr, chl, cl0, cla, dgd, lhg, lmg, lut, pqn, sf4 |
PDB Entry: 6jo6 (more details), 2.9 Å
SCOPe Domain Sequences for d6jo64_:
Sequence, based on SEQRES records: (download)
>d6jo64_ f.43.1.0 (4:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} lpswmpgadlpgylngtlpgdfgfdplylgqdpvklkwyaqaelmnarfamlavagilvp ellsnigfswpgagvawydagkfeyfapasslfgvqmllfawveirryqdfvkpgsanqd piftnnklpdgnepgypggifdpfgwskgdikslklkeikngrlamlafagfigqayttg ttplknlsthladpwsttvwqndlar
>d6jo64_ f.43.1.0 (4:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} lpswmpgadlpgylngtlpgdfgfdplylgqdpvklkwyaqaelmnarfamlavagilvp ellsnigpgagvawydagkfeyfapasslfgvqmllfawveirryqdfvkpgsanqdpif tnnklpdgnepgypggifdpfgwskgdikslklkeikngrlamlafagfigqayttgttp lknlsthladpwsttvwqndlar
Timeline for d6jo64_: