Lineage for d6jo6d_ (6jo6 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005547Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily)
    beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail
  4. 3005548Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) (S)
    automatically mapped to Pfam PF02531
  5. 3005549Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins)
  6. 3005562Protein automated matches [236562] (8 species)
    not a true protein
  7. 3005570Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [370481] (7 PDB entries)
  8. 3005573Domain d6jo6d_: 6jo6 D: [370500]
    Other proteins in same PDB: d6jo61_, d6jo63_, d6jo64_, d6jo65_, d6jo67_, d6jo68_, d6jo6a_, d6jo6b_, d6jo6c_, d6jo6e_, d6jo6f_, d6jo6j_, d6jo6l_, d6jo6z_
    automated match to d5l8rd_
    complexed with bcr, chl, cl0, cla, dgd, lhg, lmg, lut, pqn, sf4

Details for d6jo6d_

PDB Entry: 6jo6 (more details), 2.9 Å

PDB Description: structure of the green algal photosystem i supercomplex with light- harvesting complex i
PDB Compounds: (D:) photosystem I reaction center subunit II, chloroplastic

SCOPe Domain Sequences for d6jo6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jo6d_ d.187.1.1 (D:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
wtvptlnpdtpspifggstggllrkaqteefyvitweakkeqifemptggaaimrqgpnl
lkfgkkeqclalttqlrnkfkltpcfyrvfpdgkvqylhpadgvypekvnagrvganqnm
rrigqnvnpikvkfsgrmmspaei

SCOPe Domain Coordinates for d6jo6d_:

Click to download the PDB-style file with coordinates for d6jo6d_.
(The format of our PDB-style files is described here.)

Timeline for d6jo6d_: