Lineage for d6jo6j_ (6jo6 J:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026183Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) (S)
    automatically mapped to Pfam PF01701
  5. 3026208Family f.23.18.0: automated matches [276196] (1 protein)
    not a true family
  6. 3026209Protein automated matches [276198] (5 species)
    not a true protein
  7. 3026217Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [370433] (7 PDB entries)
  8. 3026220Domain d6jo6j_: 6jo6 J: [370434]
    Other proteins in same PDB: d6jo61_, d6jo63_, d6jo64_, d6jo65_, d6jo67_, d6jo68_, d6jo6a_, d6jo6b_, d6jo6c_, d6jo6d_, d6jo6e_, d6jo6f_, d6jo6l_, d6jo6z_
    automated match to d5l8rj_
    complexed with bcr, chl, cl0, cla, dgd, lhg, lmg, lut, pqn, sf4

Details for d6jo6j_

PDB Entry: 6jo6 (more details), 2.9 Å

PDB Description: structure of the green algal photosystem i supercomplex with light- harvesting complex i
PDB Compounds: (J:) Photosystem I reaction center subunit IX

SCOPe Domain Sequences for d6jo6j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jo6j_ f.23.18.0 (J:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mkdfttylstapviatiwftftagllieinryfpdplvf

SCOPe Domain Coordinates for d6jo6j_:

Click to download the PDB-style file with coordinates for d6jo6j_.
(The format of our PDB-style files is described here.)

Timeline for d6jo6j_: