SCOPe 2.08: Domain d6jo6e_: 6jo6 E:

Lineage for d6jo6e_ (6jo6 E:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families)

5. Family b.34.4.0: automated matches [191659] (1 protein)
   not a true family

6. Protein automated matches [191237] (8 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [370429] (7 PDB entries)

8. Domain d6jo6e_: 6jo6 E: [370430]
   Other proteins in same PDB: d6jo61_, d6jo63_, d6jo64_, d6jo65_, d6jo67_, d6jo68_, d6jo6a_, d6jo6b_, d6jo6c_, d6jo6d_, d6jo6f_, d6jo6j_, d6jo6l_, d6jo6z_
   automated match to d4y28e_
   complexed with bcr, chl, cl0, cla, dgd, lhg, lmg, lut, pqn, sf4

Details for d6jo6e_

PDB Entry: 6jo6, 2.9 Å

PDB Description: structure of the green algal photosystem i supercomplex with light- harvesting complex i

PDB Compounds: (E:) Photosystem I reaction center subunit IV, chloroplastic

SCOPe Domain Sequences for d6jo6e_:

Sequence; same for both SEQRES and ATOM records:

>d6jo6e_ b.34.4.0 (E:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
gpkrgslvkilrpesywfnqvgkvvsvdqsgvrypvvvrfenqnyagvttnnyaldevva
a

Timeline for d6jo6e_:

• d6jo6e_ first appeared in SCOPe 2.07