SCOPe 2.08: Domain d6jo67_: 6jo6 7:

Lineage for d6jo67_ (6jo6 7:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
   membrane all-alpha fold; three transmembrane helices

4. Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families)
   duplication: contains two structural repeats

5. Family f.43.1.0: automated matches [276197] (1 protein)
   not a true family

6. Protein automated matches [276200] (4 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [370435] (9 PDB entries)

8. Domain d6jo67_: 6jo6 7: [370462]
   Other proteins in same PDB: d6jo6a_, d6jo6b_, d6jo6c_, d6jo6d_, d6jo6e_, d6jo6f_, d6jo6j_, d6jo6l_
   automated match to d4xk83_
   complexed with bcr, chl, cl0, cla, dgd, lhg, lmg, lut, pqn, sf4

Details for d6jo67_

PDB Entry: 6jo6, 2.9 Å

PDB Description: structure of the green algal photosystem i supercomplex with light- harvesting complex i

PDB Compounds: (7:) Chlorophyll a-b binding protein, chloroplastic

SCOPe Domain Sequences for d6jo67_:

Sequence; same for both SEQRES and ATOM records:

>d6jo67_ f.43.1.0 (7:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
vrpvwfpgnpppahldgslagdygfdplflgqepqtlkwyvqaelvhgrfamlgaagiil
tsigakvglgfpewydagkvvveknnidfptlmviqfylmgwaetkrwydfknpgsqadg
sflgfteefkglengypggrffdpmglsrgdaakyqeykqkevkngrlamiaclgfaaqy
aatgkgpldnladhladpnhvnfatngvsipi

Timeline for d6jo67_:

• d6jo67_ first appeared in SCOPe 2.07