Lineage for d5wuxh_ (5wux H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743587Domain d5wuxh_: 5wux H: [410681]
    Other proteins in same PDB: d5wuxb1, d5wuxb2, d5wuxd1, d5wuxd2, d5wuxe_, d5wuxf_, d5wuxg_, d5wuxl1, d5wuxl2
    automated match to d6shgh_

Details for d5wuxh_

PDB Entry: 5wux (more details), 2.9 Å

PDB Description: tnfalpha-certolizumab fab
PDB Compounds: (H:) heavy

SCOPe Domain Sequences for d5wuxh_:

Sequence, based on SEQRES records: (download)

>d5wuxh_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgyvftdygmnwvrqapgkglewmgwintyigepiy
adsvkgrftfsldtskstaylqmnslraedtavyycargyrsyamdywgqgtlvtvssas
tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

Sequence, based on observed residues (ATOM records): (download)

>d5wuxh_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgyvftdygmnwvrqapgkglewmgwintyigepiy
adsvkgrftfsldtskstaylqmnslraedtavyycargyrsyamdywgqgtlvtvssas
tkgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvt
vpssslgtqtyicnvnhkpsntkvdkkvepks

SCOPe Domain Coordinates for d5wuxh_:

Click to download the PDB-style file with coordinates for d5wuxh_.
(The format of our PDB-style files is described here.)

Timeline for d5wuxh_:

  • d5wuxh_ is new in SCOPe 2.08-stable